PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C00190.1.p
Common NameEUGRSUZ_C00190, LOC104435980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 417aa    MW: 46474.7 Da    PI: 6.2476
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C00190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.4e-161462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd  l+ +++++G+g +W + ++++g++R++k+c++rw++yl
  Eucgr.C00190.1.p 14 KGPWSPEEDATLKAYIEKYGTGgNWIALPQKVGLKRCGKSCRLRWLNYL 62
                      79*********************************************97 PP

2Myb_DNA-binding38.62.5e-1269111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T+eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Eucgr.C00190.1.p  69 GGFTEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                       569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.898962IPR017930Myb domain
SuperFamilySSF466892.98E-2711109IPR009057Homeodomain-like
SMARTSM007175.6E-131364IPR001005SANT/Myb domain
PfamPF002493.7E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-251569IPR009057Homeodomain-like
CDDcd001672.52E-91662No hitNo description
PROSITE profilePS5129422.10963117IPR017930Myb domain
SMARTSM007172.3E-1167115IPR001005SANT/Myb domain
PfamPF002497.3E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2370117IPR009057Homeodomain-like
CDDcd001674.42E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDATLKAYIE KYGTGGNWIA LPQKVGLKRC GKSCRLRWLN  60
YLRPNIKHGG FTEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
RKHSINENTV MNRFSSSRTS QLNPARDLNT ASPDDDDDSS SPYNSHALSN SALERLQLHM  180
QLQTLQNPLF SSFYNNPALW PKIHPLREKM IQSLHLLNQN PNNTNGPSLI QQLALANGSQ  240
QRAEDIERNK ADIYELTSTN PNNVSLQHDS LKITASKIEE LVNSLSTSSD GSVSFNYAKN  300
LIDTALIPEV DGAEAMSYAN AFDGATSNIQ AELDDMGNNK AANHFAPRED HPNTNAEFDY  360
FKEINGCKDN ILWWSNELDT KLPSAISWDP VNNSVFQNEG LFQDYGSGAI CGSGQY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24141177108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C00190.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047010.10.0PREDICTED: transcription factor RAX2
SwissprotQ9FKL21e-103MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A059CJW50.0A0A059CJW5_EUCGR; Uncharacterized protein
STRINGPOPTR_0018s10390.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78982639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-96myb domain protein 36